PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G332500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 503aa    MW: 56856.3 Da    PI: 6.2064
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G332500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-132872348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        W+++Ed++l + +  +G+++W+ Ia+ +   +t  qc+ rw++yl
  Aqcoe3G332500.2.p 28 TWSQQEDDILREQISIHGTENWAIIAAQFK-DKTTRQCRRRWYTYL 72
                       6****************************9.*************97 PP

2Myb_DNA-binding45.22.2e-1478121146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g W++eEd++l +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
  Aqcoe3G332500.2.p  78 KGGWSQEEDLILCEAQKIYGNR-WTEIAKVVS-GRTDNAVKNRFST 121
                        688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8542172IPR017930Myb domain
SuperFamilySSF466893.03E-2525119IPR009057Homeodomain-like
SMARTSM007171.8E-122574IPR001005SANT/Myb domain
CDDcd001671.61E-112872No hitNo description
PfamPF139211.4E-132986No hitNo description
Gene3DG3DSA:1.10.10.603.3E-192980IPR009057Homeodomain-like
PROSITE profilePS5129421.06373127IPR017930Myb domain
SMARTSM007176.1E-1577125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1981126IPR009057Homeodomain-like
CDDcd001672.14E-1081122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MKLHDITKST TTSTSTTISK QKERHIVTWS QQEDDILREQ ISIHGTENWA IIAAQFKDKT  60
TRQCRRRWYT YLNSDFKKGG WSQEEDLILC EAQKIYGNRW TEIAKVVSGR TDNAVKNRFS  120
TLCKKRAKHE ALLKENHSLS CAKQNNKRAL FKNEFITNDT SESAPPLKKM RTHILDITES  180
CKLNERLHIK NGTTENQLLR PPFTVLVQNS HDVNDLPAQQ NFDSTSTATN DDENSKVQRT  240
FLRRDDPRIT ALMQQAELLS SLAVKVNTEN DNQSLENAWK ELQDFLKNNN ENDLLGCQIA  300
ESDFPFDDLM HLLEESSNME GLPCWRQPNL YESPGSSGYS TGSTLQQQTA NQKTEHPKVE  360
NTIVAQESII FEENDGCEDG FIGSSVTSVC EQSTHTDIKV DDCGWVNNFH ISESVAQVTN  420
RLSSDEKENE VGSVDLPKTE FTSPVRVTPL FKTFAAAIPT PKFSESEKHF LMKTLGVASP  480
SPNPSHNHSQ PPPCRRALLH SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-272912710108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256812.10.0PREDICTED: myb-related protein A
TrEMBLA0A061EAQ00.0A0A061EAQ0_THECC; Myb124, putative isoform 2
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-140myb domain protein 88